Recombinant Human Interleukin enhancer-binding factor 2 (ILF2)
Catalog Number:
CSB-RP001144H
- Images (0)
| Article Name: | Recombinant Human Interleukin enhancer-binding factor 2 (ILF2) |
| Biozol Catalog Number: | CSB-RP001144H |
| Supplier Catalog Number: | CSB-RP001144h |
| Alternative Catalog Number: | CSB-RP001144H-1, CSB-RP001144H-100, CSB-RP001144H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Nuclear factor of activated T-cells 45KDA |
| Molecular Weight: | 70.1 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | Q12905 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-390aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVM |
Product Guarantee and Expert Support
