Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)
Catalog Number:
CSB-RP004144H
- Images (0)
| Article Name: | Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) |
| Biozol Catalog Number: | CSB-RP004144H |
| Supplier Catalog Number: | CSB-RP004144h |
| Alternative Catalog Number: | CSB-RP004144H-1, CSB-RP004144H-100, CSB-RP004144H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cytochrome c oxidase polypeptide Va,CSB-PR2024 |
| Molecular Weight: | 39.5 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P20674 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 42-150aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV |
Product Guarantee and Expert Support
