Recombinant Human Heat shock factor-binding protein 1 (HSBP1), partial
Catalog Number:
CSB-RP004544H
- Images (0)
| Article Name: | Recombinant Human Heat shock factor-binding protein 1 (HSBP1), partial |
| Biozol Catalog Number: | CSB-RP004544H |
| Supplier Catalog Number: | CSB-RP004544h |
| Alternative Catalog Number: | CSB-RP004544H-1, CSB-RP004544H-100, CSB-RP004544H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Nasopharyngeal carcinoma-associated antigen 13 ,NPC-A-13 |
| Molecular Weight: | 35.5 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | O75506 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-75aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQK |
Product Guarantee and Expert Support
