Recombinant Human Active regulator of SIRT1 protein (RPS19BP1)
Catalog Number:
CSB-RP006544H
- Images (0)
| Article Name: | Recombinant Human Active regulator of SIRT1 protein (RPS19BP1) |
| Biozol Catalog Number: | CSB-RP006544H |
| Supplier Catalog Number: | CSB-RP006544h |
| Alternative Catalog Number: | CSB-RP006544H-1, CSB-RP006544H-100, CSB-RP006544H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 40S ribosomal protein S19-binding protein 1 Short name: RPS19-binding protein 1 Short name: S19BP |
| Molecular Weight: | 42.4 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | Q86WX3 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-145aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS |
Product Guarantee and Expert Support
