Recombinant Human Death domain-associated protein 6 (DAXX), partial
Catalog Number:
CSB-RP012444H
- Images (0)
| Article Name: | Recombinant Human Death domain-associated protein 6 (DAXX), partial |
| Biozol Catalog Number: | CSB-RP012444H |
| Supplier Catalog Number: | CSB-RP012444h |
| Alternative Catalog Number: | CSB-RP012444H-1, CSB-RP012444H-100, CSB-RP012444H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Daxx ,hDaxxETS1-associated protein 1 ,EAP1Fas death domain-associated protein |
| Molecular Weight: | 52.7 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | Q9UER7 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-233aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLI |
Product Guarantee and Expert Support
