Recombinant Human Dynein light chain 1, Cytoplasmic domain (DYNLL1)
Catalog Number:
CSB-RP012844H
- Images (0)
| Article Name: | Recombinant Human Dynein light chain 1, Cytoplasmic domain (DYNLL1) |
| Biozol Catalog Number: | CSB-RP012844H |
| Supplier Catalog Number: | CSB-RP012844h |
| Alternative Catalog Number: | CSB-RP012844H-1, CSB-RP012844H-100, CSB-RP012844H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 8KDA dynein light chain ,DLC8Dynein light chain LC8-type 1,Protein inhibitor of neuronal nitric oxide synthase ,PIN,CSB-PR2024 |
| Molecular Weight: | 37.4 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P63167 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-89aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
Product Guarantee and Expert Support
