Recombinant Human Proteasome subunit beta type-4 (PSMB4)
Catalog Number:
CSB-RP013744H
- Images (0)
| Article Name: | Recombinant Human Proteasome subunit beta type-4 (PSMB4) |
| Biozol Catalog Number: | CSB-RP013744H |
| Supplier Catalog Number: | CSB-RP013744h |
| Alternative Catalog Number: | CSB-RP013744H-1, CSB-RP013744H-100, CSB-RP013744H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 26KDA prosomal protein ,HsBPROS26 ,PROS-26Macropain beta chain,Multicatalytic endopeptidase complex beta chain,Proteasome beta chain,Proteasome chain 3 ,HsN3 |
| Molecular Weight: | 51.4 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P28070 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 46-264aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE |
Product Guarantee and Expert Support
