Recombinant Human Prefoldin subunit 1 (PFDN1)
Catalog Number:
CSB-RP014854H
- Images (0)
| Article Name: | Recombinant Human Prefoldin subunit 1 (PFDN1) |
| Biozol Catalog Number: | CSB-RP014854H |
| Supplier Catalog Number: | CSB-RP014854h |
| Alternative Catalog Number: | CSB-RP014854H-1, CSB-RP014854H-100, CSB-RP014854H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | PDF, PFD1, PFD1_HUMAN, pfdn1, Prefoldin 1, Prefoldin subunit 1 |
| Molecular Weight: | 41.1 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | O60925 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-122aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ |
Product Guarantee and Expert Support
