Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7)
Catalog Number:
CSB-RP015944H
- Images (0)
| Article Name: | Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7) |
| Biozol Catalog Number: | CSB-RP015944H |
| Supplier Catalog Number: | CSB-RP015944h |
| Alternative Catalog Number: | CSB-RP015944H-1, CSB-RP015944H-100, CSB-RP015944H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cell adhesion protein SQM1Complex I-B18 ,CI-B18NADH-ubiquinone oxidoreductase B18 subunit |
| Molecular Weight: | 43.3 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P17568 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-137aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL |
Product Guarantee and Expert Support
