Recombinant Human Histone H2B type 1-C/E/F/G/I (H2BC4), partial
Catalog Number:
CSB-RP016944H
- Images (0)
| Article Name: | Recombinant Human Histone H2B type 1-C/E/F/G/I (H2BC4), partial |
| Biozol Catalog Number: | CSB-RP016944H |
| Supplier Catalog Number: | CSB-RP016944h |
| Alternative Catalog Number: | CSB-RP016944H-1, CSB-RP016944H-100, CSB-RP016944H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Histone H2B.1 AHistone H2B.a ,H2B/aHistone H2B.g ,H2B/gHistone H2B.h ,H2B/hHistone H2B.k ,H2B/kHistone H2B.l ,H2B/l,CSB-PR2024 |
| Molecular Weight: | 40.6 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P62807 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-125aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS |
Product Guarantee and Expert Support
