Recombinant Human 60S ribosomal protein L5 (RPL5)
Catalog Number:
CSB-RP024954H
- Images (0)
| Article Name: | Recombinant Human 60S ribosomal protein L5 (RPL5) |
| Biozol Catalog Number: | CSB-RP024954H |
| Supplier Catalog Number: | CSB-RP024954h |
| Alternative Catalog Number: | CSB-RP024954H-1, CSB-RP024954H-100, CSB-RP024954H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 60S ribosomal protein L5, DBA6, L5, MSTP030, PPP1R135, protein phosphatase 1, regulatory subunit 135, Ribosomal protein L5, RL5, RL5_HUMAN, RP L5, RPL 5, RPL5, U21 RNA, U21RNA |
| Molecular Weight: | 61.2 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P46777 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-297aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEK |
Product Guarantee and Expert Support
