Recombinant Human Tenascin (TNC), partial Preis auf Anfrage
Catalog Number:
CSB-RP115094H(C)
- Images (0)
| Article Name: | Recombinant Human Tenascin (TNC), partial Preis auf Anfrage |
| Biozol Catalog Number: | CSB-RP115094H(C) |
| Supplier Catalog Number: | CSB-RP115094h(C) |
| Alternative Catalog Number: | CSB-RP115094H(C)-1,CSB-RP115094H(C)-100,CSB-RP115094H(C)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cytotactin,GMEMGP 150-225Glioma-associated-Extracellular domain matrix antigenHexabrachionJIMyotendinous antigenNeuronectin,Tenascin-C ,TN-C |
| Molecular Weight: | 39.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P24821 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1888-2201aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYK |
Product Guarantee and Expert Support
