Rcombinant Human Basigin (BSG), partial Preis auf Anfrage
Catalog Number:
CSB-RP117574H
- Images (0)
| Article Name: | Rcombinant Human Basigin (BSG), partial Preis auf Anfrage |
| Biozol Catalog Number: | CSB-RP117574H |
| Supplier Catalog Number: | CSB-RP117574h |
| Alternative Catalog Number: | CSB-RP117574H-1,CSB-RP117574H-100,CSB-RP117574H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 5A11 antigen, 5F7, BASI_HUMAN, Basigin (Ok blood group), Basigin, Blood brain barrier HT7 antigen, Bsg, CD 147, CD147, CD147 antigen, Collagenase stimulatory factor, EMMPRIN, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6 |
| Molecular Weight: | 24.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P35613 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 138-321aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH |
Product Guarantee and Expert Support
