Recombinant Human cDNA FLJ56323, highly similar to Methylated-DNA--protein-cysteinemethyltransferase (EC 2.1.1.63), partial Preis auf Anfrage

Catalog Number: CSB-RP118594H
Article Name: Recombinant Human cDNA FLJ56323, highly similar to Methylated-DNA--protein-cysteinemethyltransferase (EC 2.1.1.63), partial Preis auf Anfrage
Biozol Catalog Number: CSB-RP118594H
Supplier Catalog Number: CSB-RP118594h
Alternative Catalog Number: CSB-RP118594H-1,CSB-RP118594H-100,CSB-RP118594H-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: /
Molecular Weight: 28.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: B4DEE8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 4-238aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QPAPLERFASRRPQVLAVRTVCDLVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN