Recombinant Human Tumor necrosis factor alpha-induced protein 8 (TNFAIP8) Preis auf Anfrage
Catalog Number:
CSB-RP119544H
- Images (0)
| Article Name: | Recombinant Human Tumor necrosis factor alpha-induced protein 8 (TNFAIP8) Preis auf Anfrage |
| Biozol Catalog Number: | CSB-RP119544H |
| Supplier Catalog Number: | CSB-RP119544h |
| Alternative Catalog Number: | CSB-RP119544H-1,CSB-RP119544H-100,CSB-RP119544H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Head and neck tumor and metastasis-related protein,MDC-3.13NF-kappa-B-inducible DED-containing protein ,NDEDSCC-S2TNF-induced protein GG2-1 |
| Molecular Weight: | 49.9 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | O95379 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-198aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI |
Product Guarantee and Expert Support
