Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic (CM1), partial Preis auf Anfrage
Catalog Number:
CSB-RP134794PL
- Images (0)
| Article Name: | Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic (CM1), partial Preis auf Anfrage |
| Biozol Catalog Number: | CSB-RP134794PL |
| Supplier Catalog Number: | CSB-RP134794Pl |
| Alternative Catalog Number: | CSB-RP134794PL-1,CSB-RP134794PL-100,CSB-RP134794PL-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | CM-1 |
| Molecular Weight: | 31.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P42738 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 3-247aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ASLLMRSSCCSSAIGGFFDHRRELSTSTPISTLLPLPSTKSSFSVRCSLPQPSKPRSGTSSVHAVMTLAGSLTGKKRVDESESLTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQYPKVLHFAADSININKKIWNMYFRDLVPRLVKKGDDGNYGSTAVCDAICLQCLSKRIHYGKFVAEAKFQASPEA |
Product Guarantee and Expert Support
