Recombinant Human CCAAT/enhancer-binding protein gamma (CEBPG), partial
Catalog Number:
CSB-RP135574H
- Images (0)
| Article Name: | Recombinant Human CCAAT/enhancer-binding protein gamma (CEBPG), partial |
| Biozol Catalog Number: | CSB-RP135574H |
| Supplier Catalog Number: | CSB-RP135574h |
| Alternative Catalog Number: | CSB-RP135574H-1, CSB-RP135574H-100, CSB-RP135574H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | C/EBP gamma, CCAAT/enhancer binding protein (C/EBP) gamma, CCAAT/enhancer binding protein gamma, CCAAT/enhancer-binding protein gamma, CEBPG, CEBPG_HUMAN, GPE1BP, IG/EBP 1, IG/EBP1 |
| Molecular Weight: | 20.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P53567 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-148aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNA |
Product Guarantee and Expert Support
