Recombinant Lemna minor ATP synthase subunit beta, chloroplastic (atpB)
Catalog Number:
CSB-RP139994PL
- Images (0)
| Article Name: | Recombinant Lemna minor ATP synthase subunit beta, chloroplastic (atpB) |
| Biozol Catalog Number: | CSB-RP139994PL |
| Supplier Catalog Number: | CSB-RP139994Pl |
| Alternative Catalog Number: | CSB-RP139994PL-1, CSB-RP139994PL-100, CSB-RP139994PL-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ATP synthase F1 sector subunit beta |
| Molecular Weight: | 57.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | A9L9A3 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-497aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MQINPTTSGTAVSQLEEKNLGRVAQIIGPVLDVVFPPGKMPNIYNALVVKGQDADGQEIKVTCEVQQLLGNNRVRAVAMSATDGLTRGMDVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFIQLDTKLAIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEKNITESKVALVYGQMNEPPGARMRVGLTAL |
Product Guarantee and Expert Support
