Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial
Catalog Number:
CSB-RP143774BA(N)
- Images (0)
| Article Name: | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial |
| Biozol Catalog Number: | CSB-RP143774BA(N) |
| Supplier Catalog Number: | CSB-RP143774Ba(N) |
| Alternative Catalog Number: | CSB-RP143774BA(N)-1, CSB-RP143774BA(N)-100, CSB-RP143774BA(N)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | vacA, HP_0887, Vacuolating cytotoxin autotransporter [Cleaved into: Vacuolating cytotoxin, Vacuolating cytotoxin translocator] |
| Molecular Weight: | 26.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P55981 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 37-245aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN |
Product Guarantee and Expert Support
