Recombinant Bovine Angiogenin-1 (ANG1)
Catalog Number:
CSB-RP146794B
- Images (0)
| Article Name: | Recombinant Bovine Angiogenin-1 (ANG1) |
| Biozol Catalog Number: | CSB-RP146794B |
| Supplier Catalog Number: | CSB-RP146794B |
| Alternative Catalog Number: | CSB-RP146794B-1, CSB-RP146794B-100, CSB-RP146794B-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ANG1, ANGAngiogenin-1, EC 3.1.27.- |
| Molecular Weight: | 18.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P10152 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 24-148aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMKNRRLTRPCKDRNTFIHGNKNDIKAICEDRNGQPYRGDLRISKSEFQITICKHKGGSSRPPCRYGATEDSRVIVVGCENGLPVHFDESFITPRH |
Product Guarantee and Expert Support
