Recombinant Human Glutamyl aminopeptidase (ENPEP), partial
Catalog Number:
CSB-RP147594H(C)
- Images (0)
| Article Name: | Recombinant Human Glutamyl aminopeptidase (ENPEP), partial |
| Biozol Catalog Number: | CSB-RP147594H(C) |
| Supplier Catalog Number: | CSB-RP147594h(c) |
| Alternative Catalog Number: | CSB-RP147594H(C)-1, CSB-RP147594H(C)-100, CSB-RP147594H(C)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Aminopeptidase A ,AP-ADifferentiation antigen gp160, CD249,CSB-PR2024 |
| Molecular Weight: | 31 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q07075 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 719-949aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW |
Product Guarantee and Expert Support
