Recombinant Mouse Egl nine homolog 3 protein (Egln3) Preis auf Anfrage
Catalog Number:
CSB-RP147974M
- Images (0)
| Article Name: | Recombinant Mouse Egl nine homolog 3 protein (Egln3) Preis auf Anfrage |
| Biozol Catalog Number: | CSB-RP147974M |
| Supplier Catalog Number: | CSB-RP147974m |
| Alternative Catalog Number: | CSB-RP147974M-1,CSB-RP147974M-100,CSB-RP147974M-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Hypoxia-inducible factor prolyl hydroxylase 3 ,HIF-PH3 ,HIF-prolyl hydroxylase 3 ,HPH-3,Prolyl hydroxylase domain-containing protein 3 ,PHD3SM-20 |
| Molecular Weight: | 31.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q91UZ4 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-239aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | PLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHYNGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAINFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFVADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALAKD |
Product Guarantee and Expert Support
