Recombinant Human HLA class II histocompatibility antigen, DQ alpha 2 chain (HLA-DQA2), partial Preis auf Anfrage
Catalog Number:
CSB-RP148294H
- Images (0)
| Article Name: | Recombinant Human HLA class II histocompatibility antigen, DQ alpha 2 chain (HLA-DQA2), partial Preis auf Anfrage |
| Biozol Catalog Number: | CSB-RP148294H |
| Supplier Catalog Number: | CSB-RP148294h |
| Alternative Catalog Number: | CSB-RP148294H-1,CSB-RP148294H-100,CSB-RP148294H-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | DX alpha chainHLA class II histocompatibility antigen, DQ(6) alpha chainHLA-DQA1MHC class II DQA2 |
| Molecular Weight: | 25.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P01906 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 24-214aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSKFPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSE |
Product Guarantee and Expert Support
