Recombinant Mycobacterium tuberculosis Phosphate-binding protein PstS 1 (pstS1), partial Preis auf Anfrage
Catalog Number:
CSB-RP149194BA
- Images (0)
| Article Name: | Recombinant Mycobacterium tuberculosis Phosphate-binding protein PstS 1 (pstS1), partial Preis auf Anfrage |
| Biozol Catalog Number: | CSB-RP149194BA |
| Supplier Catalog Number: | CSB-RP149194Ba |
| Alternative Catalog Number: | CSB-RP149194BA-1,CSB-RP149194BA-100,CSB-RP149194BA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Antigen Ag78 Protein antigen B Short name: PAB |
| Molecular Weight: | 39.8 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P9WGU0 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 24-373aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPD |
Product Guarantee and Expert Support
