Recombinant Sporosarcina ureae Phenylalanine dehydrogenase (pdh) Preis auf Anfrage

Catalog Number: CSB-RP150094BA
Article Name: Recombinant Sporosarcina ureae Phenylalanine dehydrogenase (pdh) Preis auf Anfrage
Biozol Catalog Number: CSB-RP150094BA
Supplier Catalog Number: CSB-RP150094Ba
Alternative Catalog Number: CSB-RP150094BA-1,CSB-RP150094BA-100,CSB-RP150094BA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: pdhPhenylalanine dehydrogenase, PheDH, EC 1.4.1.20
Molecular Weight: 45.3 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P97014
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-379aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MILVTLEQTLQDDKASVLDKMVEHEQILFCHDKATGLQAIIAVHDTTMGPALGGCRMAPYKTMDLALKDVLRLSKGMTYKCAAADVDFGGGKSVIIGDPLKDKTPEKFRAFGQFIESLNGRFYTGTDMGTTLEDFVHAMKETNYIVGKPVEYGGGGDSSIPTALGVFYGIKATNQNLFGDDKVEGRKYSIQGLGKVGYKVAEHIINEGGNVIVTDINEQAIADIQKLGGSAVRVVSSEEIYSQQADVFVPCAFG