Recombinant Human Caspase-7 (CASP7), partial
Catalog Number:
CSB-RP154794H(A4)
- Images (0)
| Article Name: | Recombinant Human Caspase-7 (CASP7), partial |
| Biozol Catalog Number: | CSB-RP154794H(A4) |
| Supplier Catalog Number: | CSB-RP154794h(A4) |
| Alternative Catalog Number: | CSB-RP154794H(A4)-1, CSB-RP154794H(A4)-100, CSB-RP154794H(A4)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Apoptotic protease Mch-3CMH-1ICE-like apoptotic protease 3 ,ICE-LAP3 |
| Molecular Weight: | 15.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P55210 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 207-303aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ |
Product Guarantee and Expert Support
