Recombinant Rat Vasopressin V1a receptor (Avpr1a), partial
Catalog Number:
CSB-RP156244R
- Images (0)
| Article Name: | Recombinant Rat Vasopressin V1a receptor (Avpr1a), partial |
| Biozol Catalog Number: | CSB-RP156244R |
| Supplier Catalog Number: | CSB-RP156244r |
| Alternative Catalog Number: | CSB-RP156244R-1, CSB-RP156244R-100, CSB-RP156244R-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | AVPR V1aAntidiuretic hormone receptor 1aVascular/hepatic-type arginine vasopressin receptor |
| Molecular Weight: | 31.9 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P30560 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 7-52aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK |
Product Guarantee and Expert Support
