Recombinant Human Cation-independent mannose-6-phosphate receptor (IGF2R), partial
Catalog Number:
CSB-YP011093HU
- Images (0)
| Article Name: | Recombinant Human Cation-independent mannose-6-phosphate receptor (IGF2R), partial |
| Biozol Catalog Number: | CSB-YP011093HU |
| Supplier Catalog Number: | CSB-YP011093HU |
| Alternative Catalog Number: | CSB-YP011093HU-1, CSB-YP011093HU-100, CSB-YP011093HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (CI Man-6-P receptor)(CI-MPR)(M6PR)(300 kDa mannose 6-phosphate receptor)(MPR 300)(Insulin-like growth factor 2 receptor)(Insulin-like growth factor II receptor)(IGF-II receptor)(M6P/IGF2 receptor)(M6P/IGF2R)(CD antigen CD222) |
| Molecular Weight: | 20.7 kDa |
| Tag: | C-terminal 6xHis-Myc-tagged |
| UniProt: | P11717 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 628-772aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP |
Product Guarantee and Expert Support
