Recombinant Human Interleukin-12 subunit beta (IL12B)

Product Overview

• Article Name: Recombinant Human Interleukin-12 subunit beta (IL12B)
• Biozol Catalog Number: CSB-YP011587HU
• Supplier Catalog Number: CSB-YP011587HU
• Alternative Catalog Number: CSB-YP011587HU-1, CSB-YP011587HU-100, CSB-YP011587HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: (Cytotoxic lymphocyte maturation factor 40 kDa subunit)(CLMF p40)(IL-12 subunit p40)(NK cell stimulatory factor chain 2)(NKSF2),CSB-PR2024

Product Properties

• Molecular Weight: 36.8 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P29460
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Expression System: 23-328aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQ