Recombinant Mouse Interleukin-18 (Il18) (N36H,M85A,K87G,E90R,V91A,L94K)
Catalog Number:
CSB-YP011608MO(M)
- Images (0)
| Article Name: | Recombinant Mouse Interleukin-18 (Il18) (N36H,M85A,K87G,E90R,V91A,L94K) |
| Biozol Catalog Number: | CSB-YP011608MO(M) |
| Supplier Catalog Number: | CSB-YP011608MO(M) |
| Alternative Catalog Number: | CSB-YP011608MO(M)-1, CSB-YP011608MO(M)-100, CSB-YP011608MO(M)-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (IL-18)(Interferon gamma-inducing factor)(IFN-gamma-inducing factor)(Interleukin-1 gamma)(IL-1 gamma) |
| Molecular Weight: | 20.5 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P70380 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 36-192aa(N36H,M85A,K87G,E90R,V91A,L94K) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | HFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYAYGDSRARGKAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS |
Product Guarantee and Expert Support
