Recombinant Mouse Interleukin-18 (Il18)
Catalog Number:
CSB-YP011608MOE1
- Images (0)
| Article Name: | Recombinant Mouse Interleukin-18 (Il18) |
| Biozol Catalog Number: | CSB-YP011608MOE1 |
| Supplier Catalog Number: | CSB-YP011608MOe1 |
| Alternative Catalog Number: | CSB-YP011608MOE1-1, CSB-YP011608MOE1-100, CSB-YP011608MOE1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Interferon gamma-inducing factor |
| Molecular Weight: | 22.1 kDa |
| Tag: | Tag-Free |
| UniProt: | P70380 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-192aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS |
Product Guarantee and Expert Support
