Recombinant Macaca fascicularis Interleukin-1 alpha (IL1A)
Catalog Number:
CSB-YP011613MOV
- Images (0)
| Article Name: | Recombinant Macaca fascicularis Interleukin-1 alpha (IL1A) |
| Biozol Catalog Number: | CSB-YP011613MOV |
| Supplier Catalog Number: | CSB-YP011613MOV |
| Alternative Catalog Number: | CSB-YP011613MOV-1, CSB-YP011613MOV-100, CSB-YP011613MOV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (IL-1 alpha)(Hematopoietin-1),CSB-PR2024 |
| Molecular Weight: | 21.9 kDa |
| Tag: | C-terminal 6xHis-Myc-tagged |
| UniProt: | P79340 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 113-271aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQYLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEIPKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA |
Product Guarantee and Expert Support
