Recombinant Macaca mulatta Interleukin-1 alpha (IL1A)

Catalog Number: CSB-YP011613MOW
Article Name: Recombinant Macaca mulatta Interleukin-1 alpha (IL1A)
Biozol Catalog Number: CSB-YP011613MOW
Supplier Catalog Number: CSB-YP011613MOW
Alternative Catalog Number: CSB-YP011613MOW-1, CSB-YP011613MOW-100, CSB-YP011613MOW-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Hematopoietin-1
Molecular Weight: 20.1 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P48089
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 113-271aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA