Recombinant mouse Interleukin-2 receptor subunit beta (Il2rb), partial
Catalog Number:
CSB-YP011650MO
- Images (0)
| Article Name: | Recombinant mouse Interleukin-2 receptor subunit beta (Il2rb), partial |
| Biozol Catalog Number: | CSB-YP011650MO |
| Supplier Catalog Number: | CSB-YP011650MO |
| Alternative Catalog Number: | CSB-YP011650MO-1, CSB-YP011650MO-100, CSB-YP011650MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | High affinity IL-2 receptor subunit betap70-75, CD122,CSB-PR2024 |
| Molecular Weight: | 27.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P16297 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 27-240aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE |
Product Guarantee and Expert Support
