Recombinant Dog Interleukin-33 (IL33), partial
Catalog Number:
CSB-YP011656DO
- Images (0)
| Article Name: | Recombinant Dog Interleukin-33 (IL33), partial |
| Biozol Catalog Number: | CSB-YP011656DO |
| Supplier Catalog Number: | CSB-YP011656DO |
| Alternative Catalog Number: | CSB-YP011656DO-1, CSB-YP011656DO-100, CSB-YP011656DO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (IL-33)(Protein DVS27) |
| Molecular Weight: | 19.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | O97863 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 102-263aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CFGRANVPSIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS |
Product Guarantee and Expert Support
