Recombinant Dog Interleukin-8 (IL8)
Catalog Number:
CSB-YP011671DO
- Images (0)
| Article Name: | Recombinant Dog Interleukin-8 (IL8) |
| Biozol Catalog Number: | CSB-YP011671DO |
| Supplier Catalog Number: | CSB-YP011671DO |
| Alternative Catalog Number: | CSB-YP011671DO-1, CSB-YP011671DO-100, CSB-YP011671DO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | C-X-C motif chemokine hemokine (C-X-C motif) ligand 8 |
| Molecular Weight: | 11.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P41324 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 23-101aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
Product Guarantee and Expert Support
