Recombinant Human Interleukin-8 (CXCL8), partial
Catalog Number:
CSB-YP011671HU
- Images (0)
| Article Name: | Recombinant Human Interleukin-8 (CXCL8), partial |
| Biozol Catalog Number: | CSB-YP011671HU |
| Supplier Catalog Number: | CSB-YP011671HU |
| Alternative Catalog Number: | CSB-YP011671HU-1, CSB-YP011671HU-100, CSB-YP011671HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | C-X-C motif chemokine 8 Chemokine (C-X-C motif) ligand 8 Emoctakin Granulocyte chemotactic protein 1 Short name: GCP-1 Monocyte-derived neutrophil chemotactic factor Short name: MDNCF Monocyte-derived neutrophil-activating peptide Short name: MONAP Neutr |
| Molecular Weight: | 10.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P10145 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 23-99aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
Product Guarantee and Expert Support
