Recombinant Mouse Interferon regulatory factor 3 (Irf3)
Catalog Number:
CSB-YP011818MO
- Images (0)
| Article Name: | Recombinant Mouse Interferon regulatory factor 3 (Irf3) |
| Biozol Catalog Number: | CSB-YP011818MO |
| Supplier Catalog Number: | CSB-YP011818MO |
| Alternative Catalog Number: | CSB-YP011818MO-1, CSB-YP011818MO-100, CSB-YP011818MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Short name:IRF-3 |
| Molecular Weight: | 50.9 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P70671 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 1-419aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | METPKPRILPWLVSQLDLGQLEGVAWLDESRTRFRIPWKHGLRQDAQMADFGIFQAWAEASGAYTPGKDKPDVSTWKRNFRSALNRKEVLRLAADNSKDPYDPHKVYEFVTPGARDFVHLGASPDTNGKSSLPHSQENLPKLFDGLILGPLKDEGSSDLAIVSDPSQQLPSPNVNNFLNPAPQENPLKQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRLVGSTADMTLPWQPVTLPDPEGFLTDKLVKEYV |
Product Guarantee and Expert Support
