Recombinant Human Integrin alpha-IIb (ITGA2B), partial
Catalog Number:
CSB-YP011865HU
- Images (0)
| Article Name: | Recombinant Human Integrin alpha-IIb (ITGA2B), partial |
| Biozol Catalog Number: | CSB-YP011865HU |
| Supplier Catalog Number: | CSB-YP011865HU |
| Alternative Catalog Number: | CSB-YP011865HU-1, CSB-YP011865HU-100, CSB-YP011865HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | GPalpha IIb ,GPIIbPlatelet membrane glycoprotein IIb, CD41 |
| Molecular Weight: | 29 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P08514 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 639-887aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR |
Product Guarantee and Expert Support
