Recombinant Human Potassium channel subfamily K member 2 (KCNK2), partial

Catalog Number: CSB-YP012070HU
Article Name: Recombinant Human Potassium channel subfamily K member 2 (KCNK2), partial
Biozol Catalog Number: CSB-YP012070HU
Supplier Catalog Number: CSB-YP012070HU
Alternative Catalog Number: CSB-YP012070HU-1, CSB-YP012070HU-100, CSB-YP012070HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Outward rectifying potassium channel protein TREK-1 TREK-1 K(+) channel subunit Two pore domain potassium channel TREK-1 Two pore potassium channel TPKC1
Molecular Weight: 17.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: O95069
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 1-143aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD