Recombinant Mouse Galectin-7 (Lgals7)

Catalog Number: CSB-YP012892MO
Article Name: Recombinant Mouse Galectin-7 (Lgals7)
Biozol Catalog Number: CSB-YP012892MO
Supplier Catalog Number: CSB-YP012892MO
Alternative Catalog Number: CSB-YP012892MO-1, CSB-YP012892MO-100, CSB-YP012892MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Lgals7, Galectin-7, Gal-7
Molecular Weight: 17 kDa
Tag: N-terminal 6xHis-tagged
UniProt: O54974
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 2-136aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF