Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5), partial

Product Overview

• Article Name: Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5), partial
• Biozol Catalog Number: CSB-YP012906HU
• Supplier Catalog Number: CSB-YP012906HU
• Alternative Catalog Number: CSB-YP012906HU-1, CSB-YP012906HU-100, CSB-YP012906HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: G-protein coupled receptor 49G-protein coupled receptor 67G-protein coupled receptor HG38

Product Properties

• Molecular Weight: 62.4 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O75473
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Expression System: 22-561aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEK