Recombinant Rat Lutropin-choriogonadotropic hormone receptor (Lhcgr), partial
Catalog Number:
CSB-YP012911RA
- Images (0)
| Article Name: | Recombinant Rat Lutropin-choriogonadotropic hormone receptor (Lhcgr), partial |
| Biozol Catalog Number: | CSB-YP012911RA |
| Supplier Catalog Number: | CSB-YP012911RA |
| Alternative Catalog Number: | CSB-YP012911RA-1, CSB-YP012911RA-100, CSB-YP012911RA-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Luteinizing hormone receptor ,LSH-R |
| Molecular Weight: | 39.2 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P16235 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 27-362aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYP |
Product Guarantee and Expert Support
