Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5 (LILRA5), partial

Product Overview

• Article Name: Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5 (LILRA5), partial
• Biozol Catalog Number: CSB-YP012937HU
• Supplier Catalog Number: CSB-YP012937HU
• Alternative Catalog Number: CSB-YP012937HU-1, CSB-YP012937HU-100, CSB-YP012937HU-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: CD85 antigen-like family member FImmunoglobulin-like transcript 11 ,ILT-11Leukocyte immunoglobulin-like receptor 9 ,LIR-9, CD85f

Product Properties

• Molecular Weight: 27.2 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: A6NI73
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Expression System: 42-268aa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR