Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial
Catalog Number:
CSB-YP012941MO
- Images (0)
| Article Name: | Recombinant Mouse Leukocyte immunoglobulin-like receptor subfamily B member 3 (Lilrb3), partial |
| Biozol Catalog Number: | CSB-YP012941MO |
| Supplier Catalog Number: | CSB-YP012941MO |
| Alternative Catalog Number: | CSB-YP012941MO-1, CSB-YP012941MO-100, CSB-YP012941MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cell-surface glycoprotein p91,Paired immunoglobulin-like receptor B ,PIR-B |
| Molecular Weight: | 21.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P97484 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 664-841aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQTEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGANNQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDMEQ |
Product Guarantee and Expert Support
