Recombinant Human Mannose-binding protein C (MBL2)

Catalog Number: CSB-YP013540HU
Article Name: Recombinant Human Mannose-binding protein C (MBL2)
Biozol Catalog Number: CSB-YP013540HU
Supplier Catalog Number: CSB-YP013540HU
Alternative Catalog Number: CSB-YP013540HU-1, CSB-YP013540HU-100, CSB-YP013540HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Collectin-1MBP1Mannan-binding protein,Mannose-binding lectin
Molecular Weight: 26 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P11226
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 21-248aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI