Recombinant Mouse Macrophage migration inhibitory factor (Mif)
Catalog Number:
CSB-YP013826MO
- Images (0)
| Article Name: | Recombinant Mouse Macrophage migration inhibitory factor (Mif) |
| Biozol Catalog Number: | CSB-YP013826MO |
| Supplier Catalog Number: | CSB-YP013826MO |
| Alternative Catalog Number: | CSB-YP013826MO-1, CSB-YP013826MO-100, CSB-YP013826MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Delayed early response protein 6 (DER6) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC:5.3.3.12)) (Phenylpyruvate tautomerase) (MIF) |
| Molecular Weight: | 13.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P34884 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 2-115aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA |
Product Guarantee and Expert Support
