Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial
Catalog Number:
CSB-YP014597HU
- Images (0)
| Article Name: | Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial |
| Biozol Catalog Number: | CSB-YP014597HU |
| Supplier Catalog Number: | CSB-YP014597HU |
| Alternative Catalog Number: | CSB-YP014597HU-1, CSB-YP014597HU-100, CSB-YP014597HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Antigen identified by monoclonal Ki 67 , Antigen identified by monoclonal Ki-67, Antigen KI-67, Antigen KI67 , Antigen Ki67, KI67_HUMAN, KIA, Marker of proliferation Ki-67, MIB 1, MIB, MKI67, PPP1R105, Proliferation marker protein Ki-67, Proliferation re |
| Molecular Weight: | 17.3 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P46013 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 3120-3256aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI |
Product Guarantee and Expert Support
