Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial

Catalog Number: CSB-YP015007MO2
Article Name: Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial
Biozol Catalog Number: CSB-YP015007MO2
Supplier Catalog Number: CSB-YP015007MO2
Alternative Catalog Number: CSB-YP015007MO2-1, CSB-YP015007MO2-100, CSB-YP015007MO2-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1, CD20
Molecular Weight: 20.1 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P19437
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Yeast
Expression System: 132-291aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP