Recombinant Mouse Methylmalonyl-CoA mutase, mitochondrial (Mut)
Catalog Number:
CSB-YP015243MO
- Images (0)
| Article Name: | Recombinant Mouse Methylmalonyl-CoA mutase, mitochondrial (Mut) |
| Biozol Catalog Number: | CSB-YP015243MO |
| Supplier Catalog Number: | CSB-YP015243MO |
| Alternative Catalog Number: | CSB-YP015243MO-1, CSB-YP015243MO-100, CSB-YP015243MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Methylmalonyl-CoA isomerase (MCM) |
| Molecular Weight: | 80.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P16332 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Yeast |
| Expression System: | 31-748aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | LHQQQPLHPEWAVLAKKQLKGKNPEDLIWHTPEGISIKPLYSRADTLDLPEELPGVKPFTRGPYPTMYTYRPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGAVIPVLATFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFQYTAQHMPKFNSISISGYHMQEAGADAILELAYTIADGLE |
Product Guarantee and Expert Support
